PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29872.m000537
Common NameLOC8277220, RCOM_0980250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 442aa    MW: 48239.5 Da    PI: 5.4488
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29872.m000537genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS380.22.4e-116794393374
           GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                     lLl+cAe+v+ ++l +a  lL ++sel+sp g++++R+ +yf+ AL+ar+++s+ ++y+ l++++ + ++s++ ++a++ ++ +sP++kfsh+ta
  29872.m000537  79 GLLLQCAECVAMDNLDEAADLLPEISELSSPFGSSFERVGSYFAHALQARVVSSCLGTYSPLTSKSLTLTQSQKIFNAFQSYNSISPLIKFSHFTA 174
                    58********************************************************************************************** PP

           GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                    NqaI +a++ge+rvH+iDfdi+qGlQWp L++ LasR+++  s+RiTg+gs    s+e le+tg+rLa+fA++lg+pfef++l  k  +  ++++L
  29872.m000537 175 NQAIFQALDGEDRVHVIDFDIMQGLQWPGLFHILASRSKKIRSMRITGFGS----SSELLESTGRRLADFASSLGLPFEFHPLEGKIGSVSDISQL 266
                    ***************************************************....9**************************9777777779**** PP

           GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                     ++p+Ea++V++++  h l+d ++s       +L+l+  l+Pk+++ +eq+++h ++sFl rf+eal+yysalfd+l  +l+ +s er++vE++l+
  29872.m000537 267 GIRPREAVVVHWMH--HCLYDITGSDLG----TLRLLTLLRPKLITTAEQDLSH-AGSFLGRFVEALHYYSALFDALGDGLGIDSVERHTVEQQLF 355
                    ************99..777777777777....9*********************.899************************************** PP

           GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.eesgslvlgWkdrpLvsvSaWr 374
                    g ei+n+va  g +r+ + + +e+W + l++aGF+pv+l+ + a+qa+lll +++++gy++  ee+g+l lgWkd +L+++SaW+
  29872.m000537 356 GCEIRNIVAVGGPKRTGEVK-VERWGNELRRAGFQPVSLGGNPAAQASLLLGMFPWKGYTLVeEENGCLKLGWKDLSLLTASAWK 439
                    **************998887.9*************************************97637799999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.51551418IPR005202Transcription factor GRAS
PfamPF035148.5E-11479439IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MFQSLVPQSP PINSNSNSNS NPNNSTSSSM KTAKRTARET IAAGDDPSAK RPNLDDTAAA  60
IKEGEEEEEE DSTGLRLLGL LLQCAECVAM DNLDEAADLL PEISELSSPF GSSFERVGSY  120
FAHALQARVV SSCLGTYSPL TSKSLTLTQS QKIFNAFQSY NSISPLIKFS HFTANQAIFQ  180
ALDGEDRVHV IDFDIMQGLQ WPGLFHILAS RSKKIRSMRI TGFGSSSELL ESTGRRLADF  240
ASSLGLPFEF HPLEGKIGSV SDISQLGIRP REAVVVHWMH HCLYDITGSD LGTLRLLTLL  300
RPKLITTAEQ DLSHAGSFLG RFVEALHYYS ALFDALGDGL GIDSVERHTV EQQLFGCEIR  360
NIVAVGGPKR TGEVKVERWG NELRRAGFQP VSLGGNPAAQ ASLLLGMFPW KGYTLVEEEN  420
GCLKLGWKDL SLLTASAWKP SD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-53774394375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002528186.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLB9SQB70.0B9SQB7_RICCO; DELLA protein RGA, putative
STRINGGLYMA11G10220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-175GRAS family protein